Characteristics of carcass and non-carcass components of lambs fed diets containing silages of forages adapted to the semi-arid environment

The aim of this study was to evaluate the effects of diets containing silages of forages that are adapted to the semi-arid environment on the characteristics of the carcass and of non-carcass components of 32 mixed-breed lambs at approximately six months old, with an average live weight of 17.61 ± 2.63 kg. Lambs were assigned to four treatments (diets containing silages of Atriplex nummularia Lind, Cenchrus ciliaris, Gliricidia sepium and Manihot sp.) in a completely randomized design with eight replicates. Animals fed the diet containing old man saltbush showed higher values for the intakes of dry matter (1.080 g/day), crude protein (190 g/day) and total digestible nutrients (740 g/day), body condition score (2.81 points), fatness (2.87 points), carcass conformation (3.19 points), live weight (29.1 kg), empty bodyweight (23.41 kg), weights of the commercial cuts neck, shoulder and ribs (0.46, 0.82 and 1.12 kg, respectively), and skin weight (1.972 kg). No differences were found between the diets for carcass dressing percentage, external and internal carcass lengths, leg length and circumference, rump circumference and width, chest width and depth, full bodyweight, empty bodyweight, cooling losses, pH before and after cooling, loin, and leg. Silages of old man saltbush, buffelgrass, gliricidia and pornunça are recommended for inclusion in lamb diets. Diets with old man saltbush silage provide the best results for characteristics of the carcass and of non-carcass components besides weight gain, which can reach up to 200 g/day depending on the formulation.Keywords: Carcass composition, feedlot, saltbush, shee

Características fermentativas de silagens de capim-elefante emurchecido ou com adição de farelo de cacau Fermentation characteristics of silage of elephantgrass wilted or with addition of cocoa meal

O experimento foi realizado para avaliar as características fermentativas da silagem de capim-elefante emurchecido ou adicionado de diferentes níveis de farelo de cacau. O capim-elefante utilizado foi colhido aos 50 dias de rebrota após o corte de uniformização e submetido aos seguintes tratamentos na ensilagem: capim-elefante emurchecido ao sol por oito horas e capim-elefante sem emurchecimento adicionado de 0, 7, 14, 21 e 28% de farelo de cacau (% da matéria natural). Foram utilizadas quatro repetições por tratamento. O material foi acondicionado em silos de PVC com 0,15m de diâmetro e 0,3m de altura, adotando-se compactação de 500kg/m³. O pH reduziu e os carboidratos solúveis (CHO S) aumentaram de forma linear (PThe experiment was carried out to evaluate the fermentation characteristics of eight hours sun light wilted elephant grass silage in comparison to no sun light exposed silage added by 0, 7, 14, 21, and 28% of cocoa meal during the ensilage process. PVC silos, measuring 0.15m diameter x 0.30m height, were used to ensilage the elephantgrass using a compacting pressure of 500kg/m³. Soluble carbohydrates decreased but pH and N-NH3 increased (P<0.05) as the cocoa meal level increased in the silage. No difference between wilted and no wilted elephantgrass silages was observed for organic acid content. Addition of 0, 7, 14, 21, and 28% of cocoa meal caused an increase of 2.23, 2.48, 3.14, 3.49, and 3.87% of lactic acid contents. Addition of cocoa meal during the ensilage process enhanced fermentation quality of elephantgrass silage

Vascular effects and electrolyte homeostasis of the natriuretic peptide isolated from Crotalus oreganus abyssus (North American Grand Canyon rattlesnake) venom

Contains fulltext : 110165.pdf (Publisher’s version ) (Closed access)Crotalus oreganus abyssus is a rattlesnake that is usually found in the Grand Canyon, United States of America. Knowledge regarding the composition of C. o. abyssus venom is scarce. New natriuretic peptides (NPs) have been isolated and characterized from the venoms of members of the Crotalinae family. The NP family comprises three members, ANP (atrial natriuretic peptide), BNP (b-type natriuretic peptide) and CNP (c-type natriuretic peptide), and has an important role in blood pressure regulation and electrolyte homeostasis. The aim of the present study was to characterize a novel natriuretic-like peptide (Coa_NP2), isolated from C. o. abyssus venom. The Coa_NP2 presents an average molecular mass of 3419.88Da (theoretical average molecular mass 3418.94Da, monoisotopic molecular mass 3416.66Da and theoretical PI 7.78) and its amino acid sequence presents the loop region that is characteristic of natriuretic peptides. The peptide has 32 amino acids and its complete sequence is SYGISSGCFGLKLDRIGTMSGLGCWRLLQDSP. Coa_NP2 is a natriuretic peptide of the ANP/BNP-like family, since the carboxyterminal region of CNP has its own NP domain. We demonstrate, herein, that Coa_NP2 produces a dose-dependent decrease in mean arterial pressure in rats, followed by significant increases in concentrations of markers of nitric oxide formation measured in the plasma and vasorelaxation in a thoracic aortic ring bath. The structural and biological aspects confirm Coa_NP2 as a new natriuretic peptide, isolated from snake venom