Application of statistical learning theory to plankton image analysis

Submitted to the Joint Program in Applied Ocean Science and Engineering in partial fulfillment of the requirements for the degree of Doctor of Philosophy At the Massachusetts Institute of Technology and the Woods Hole Oceanographic Institution June 2006A fundamental problem in limnology and oceanography is the inability to quickly identify and map distributions of plankton. This thesis addresses the problem by applying statistical machine learning to video images collected by an optical sampler, the Video Plankton Recorder (VPR). The research is focused on development of a real-time automatic plankton recognition system to estimate plankton abundance. The system includes four major components: pattern representation/feature measurement, feature extraction/selection, classification, and abundance estimation. After an extensive study on a traditional learning vector quantization (LVQ) neural network (NN) classifier built on shape-based features and different pattern representation methods, I developed a classification system combined multi-scale cooccurrence matrices feature with support vector machine classifier. This new method outperforms the traditional shape-based-NN classifier method by 12% in classification accuracy. Subsequent plankton abundance estimates are improved in the regions of low relative abundance by more than 50%. Both the NN and SVM classifiers have no rejection metrics. In this thesis, two rejection metrics were developed. One was based on the Euclidean distance in the feature space for NN classifier. The other used dual classifier (NN and SVM) voting as output. Using the dual-classification method alone yields almost as good abundance estimation as human labeling on a test-bed of real world data. However, the distance rejection metric for NN classifier might be more useful when the training samples are not “good” ie, representative of the field data. In summary, this thesis advances the current state-of-the-art plankton recognition system by demonstrating multi-scale texture-based features are more suitable for classifying field-collected images. The system was verified on a very large realworld dataset in systematic way for the first time. The accomplishments include developing a multi-scale occurrence matrices and support vector machine system, a dual-classification system, automatic correction in abundance estimation, and ability to get accurate abundance estimation from real-time automatic classification. The methods developed are generic and are likely to work on range of other image classification applications.This work was supported by National Science Foundation Grants OCE-9820099 and Woods Hole Oceanographic Institution academic program

Accurate detection of dysmorphic nuclei using dynamic programming and supervised classification

A vast array of pathologies is typified by the presence of nuclei with an abnormal morphology. Dysmorphic nuclear phenotypes feature dramatic size changes or foldings, but also entail much subtler deviations such as nuclear protrusions called blebs. Due to their unpredictable size, shape and intensity, dysmorphic nuclei are often not accurately detected in standard image analysis routines. To enable accurate detection of dysmorphic nuclei in confocal and widefield fluorescence microscopy images, we have developed an automated segmentation algorithm, called Blebbed Nuclei Detector (BleND), which relies on two-pass thresholding for initial nuclear contour detection, and an optimal path finding algorithm, based on dynamic programming, for refining these contours. Using a robust error metric, we show that our method matches manual segmentation in terms of precision and outperforms state-of-the-art nuclear segmentation methods. Its high performance allowed for building and integrating a robust classifier that recognizes dysmorphic nuclei with an accuracy above 95%. The combined segmentation-classification routine is bound to facilitate nucleus-based diagnostics and enable real-time recognition of dysmorphic nuclei in intelligent microscopy workflows

Kaedah pengesanan automatik salur darah retina untuk imej digital fundus

Retinaialahsatulapisanmembranyangterletakpadabelakangmatayangboleh menggambarkankeseluruhanimejsalurdarahmenggunakankamerafundus.Struktur salur darahpadaretinamampumemberikanpetunjukpentinguntukmengenalpasti penyakit-penyakityangberkaitanmatadanbadan.Penyakitberkaitanoftalmikdapat dibuktikan denganperubahandiameter,sudutpercabangan,dankekerintinganpada salur darahretina.Olehyangdemikian,prosessaringandigalakkan,namunbegitu pemeriksaanyangdilakukanadalahsecaramanualdanmemerlukankepakaran,masa, dan kosyangtinggikeranaperalatanyangcanggih.Suatukaedahpengesanansalur darah secaraautomatikdiperlukanuntukmendapatkanimejkeseluruhanrangkaian salur darahyanglebihefektifberbandingpengesanansecaramanual.Hasilnya, keseluruhanstruktursalurdarahretinadapatdikesandengancepatdantepat.Walau bagaimanapun,pengesanansalurdarahmerupakanprosesyangrumitkeranasalur darah retinamempunyairangkaiansalurdarahyangrumitdengankepelbagaiansaiz dan lebar.Selainitu,imejretinamempunyaihingar,kontrayangrendah,danvariasi kecerahanpadaimejyangsamamenyebabkansukaruntukmembezakansalurdarah dan latarbelakang.Kehadiranlingkarancakeraoptikpadaimejretinaperludiuruskan denganbaikkeranaiamerupakankawasanpalingcerahdanpembuluhdarahberasal daripadapusatnya.Objektifutamakajianiniadalahbagimembangunkankaedah pengesananautomatiksalurdarahretinauntukimejdigitalfundusyangcekap.Ia mampu mengesansalurdarahsecaraoptimumbermuladaripadalingkarancakera optik sehinggahujungstruktursalurdarah.Penyelidikaninimencadangkantigafasa utama, iaitupra-pemprosesan,segmentasirangkaiansalurdarah,danpasca pemprosesan. Fasapra-pemprosesaninimenyediakanimejretinayanglebihbaik berbanding imejasaluntukmeningkatkankontraantarasalurdarahretinadanlatar belakang. Seterusnya,fasakeduamerupakansegmentasirangkaiansalurdarah menggunakan modelberasaskangarispengesanansudut.Kaedahinidapatmengesan piksel yangmewakilisalurdarahberdasarkanpencirianyangtelahdilakukan.Akhir sekali, fasayangketigaialahfasapascapemprosesanyangterbahagikepadadua,iaitu pengesananpikseldanpenuraspikselberkepentingan.Prosespengesanandijalankan denganmenggunakankaedahheuristikdanOtsuterubah.Prosesinimenukarkanimej skala kelabukepadaimejperduaanbagipengesanansalurdarahretina,manakalabagi proses penuraspikselberkepentingan,iaterbahagikepadapenyingkirantitiktidak berkepentingandanmemperbaikipikselyanghilang.Prosesinidijalankandengan menggunakan sudutpengagihanhistogramuntukmenentukantaburanyangdiperoleh daripadapikselkejiranan.Maklumatinikemudiannyadigunakanuntuk menyingkirkanpikselhingardanmenyambungkanpikselyanghilangyangjuga merupakansebahagiandaripadasalurdarah.Dapatankajiantelahmembuktikan kaedah yangdicadangkanberjayamengesansalurdarahdenganmenunjukkan peningkatan ketepatanbagipangkalandataDRIVE,HRF,danSTAREiaitu masing-masing 95.58%,93.40%,dan94.90%.Berbandingkaedahterdahuluyang hanyamencatatkanketepatansebanyak94.15%dan93.24%bagipangkalandata DRIVE danSTARE.Kesimpulannya,kajianinitelahberjayamembangunkankaedah pengesananautomatiksalurdarahretinauntukimejdigitalfundus

Recognition of fiducial marks applied to robotic systems

The objective was to devise a method to determine the position and orientation of the links of a PUMA 560 using fiducial marks. As a result, it is necessary to design fiducial marks and a corresponding feature extraction algorithm. The marks used are composites of three basic shapes, a circle, an equilateral triangle and a square. Once a mark is imaged, it is thresholded and the borders of each shape are extracted. These borders are subsequently used in a feature extraction algorithm. Two feature extraction algorithms are used to determine which one produces the most reliable results. The first algorithm is based on moment invariants and the second is based on the discrete version of the psi-s curve of the boundary. The latter algorithm is clearly superior for this application

Design of Cessna 210 Radome-Pod Instrument Interface for Flight Testing

The purpose of this study was to determine the most appropriate location and design for an instrument interface that can utilize minimum volume within a Cessna 210 wing-pod. This study considered some instruments such as a radiometer, heitronics pyrometer, laser altimeter and a network camera; to develop a suitable instrument interface. The study examined the process needed to implement a design methodology for instrument interfaces for flight testing. The study combined varying physiological factors to produce a design for the internal-instruments’ interface of a wing pod. These factors include but may not be limited to simulated analysis, impact on human physiology, center of gravity calculations and practicality of instrument location. Accessibility factors evidently determined the most accessible placement of the flight test instruments for maintenance as well enable effective space utilization within the wing pod. Constraints of the study resulted in an acceptable zonal placement of the instruments forward of the certified center of gravity and a design that is simply effective. The results are not outstanding as any change in instrument interface features such as weight, design and location will alter the zonal placement of the instruments by moving it further aft. Further improvements can be made by optimizing the design to improve the structural strength and loading configurations

A framework for hull form reverse engineering and geometry integration into numerical simulations

The thesis presents a ship hull form specific reverse engineering and CAD integration framework. The reverse engineering part proposes three alternative suitable reconstruction approaches namely curves network, direct surface fitting, and triangulated surface reconstruction. The CAD integration part includes surface healing, region identification, and domain preparation strategies which used to adapt the CAD model to downstream application requirements. In general, the developed framework bridges a point cloud and a CAD model obtained from IGES and STL file into downstream applications