Kinetics and Mechanisms of the Chromium(III) Reactions with 2,4- and 2,5-Dihydroxybenzoic Acids in Weak Acidic Aqueous Solutions

The reactions of 2,4- and 2,5-dihydroxybenzoic acids (dihydroxybenzoic acid, DHBA) with chromium(III) in weak acidic aqueous solutions have been shown to take place in at least two stages. The first stage of the reactions has an observed rate constant k1(obs) = k1[DHBA] + C and the corresponding activation parameters are ΔH1(2,4)≠ = 49, 5 kJ/mol−1, ΔS1(2,4)≠ = −103, 7 J mol−1 K−1, ΔH1(2,5)≠ = 60, 3 kJ/mol−1, and ΔS1(2,5)≠ = −68, 0 J mol−1 K−1. These are composite activation parameters and the breaking of the strong intramolecular hydrogen bonding in the two ligands is suggested to be the first step of the (composite) first stage of the reactions. The second stage is ligand concentration independent and is thus attributed to a chelation process. The corresponding activation parameters are ΔH2(2,4)≠ = 45, 13 kJ/mol−1, ΔS2(2,4)≠ = −185, 9 J mol−1 K−1, ΔH2(2,5)≠ = 54, 55 kJ/mol−1, and ΔS2(2,5)≠ = −154, 8 J mol−1 K−1. The activation parameters support an associative mechanism for the second stage of the reactions. The various substitution processes are accompanied by proton release, resulting in pH decrease

Reaction of Chromium(III) with 3,4-Dihydroxybenzoic Acid: Kinetics and Mechanism in Weak Acidic Aqueous Solutions

The interactions between chromium(III) and 3,4-dihydroxybenzoic acid (3,4-DHBA) were studied resulting in the formation of oxygen-bonded complexes upon substitution of water molecules in the chromium(III) coordination sphere. The experimental results show that the reaction takes place in at least three stages, involving various intermediates. The first stage was found to be linearly dependent on ligand concentration k1(obs)′ = k0 + k1(obs)[3, 4-DHBA], and the corresponding activation parameters were calculated as follows: ΔH1(obs)≠ = 51.2 ± 11.5 kJ mol−1, ΔS1(obs)≠ = −97.3 ± 28.9 J mol−1 K−1 (composite activation parameters) . The second and third stages, which are kinetically indistinguishable, do not depend on the concentrations of ligand and chromium(III), accounting for isomerization and chelation processes, respectively. The corresponding activation parameters are ΔH2(obs)≠ = 44.5 ± 5.0 kJ mol−1, ΔS2(obs)≠ = −175.8 ± 70.3 J mol−1 K−1. The observed stages are proposed to proceed via interchange dissociative (Id, first stage) and associative (second and third stages) mechanisms. The reactions are accompanied by proton release, as is shown by the pH decrease

Interaction of Ni(II) and Cu(II) with histone H2B peptide models: study of the toxicity - carcinogenicity mechanisms induced by metal ions

It has been widely established that several transition metals, such as copper and nickel, are carcinogenic to humans and/or animals. The molecular mechanism by which metal carcinogenicity is exerted is not fully understood. However, it is believed to involve DNA damage and epigenetic effects in chromatin, resulting from metal binding to the cell nucleus. It is known that Ni(II) can bind DNA through its phosphate groups and phospholipids of cellular membranes, only weakly. Therefore, the nucleus proteins, and in particular the most abundant among them, the histones, are the major candidates for metal binding. On the contrary, Cu(II) ions interact quite efficiently with DNA bases and several histone peptide models. Consequently, within the cell nucleus, those two components, compete for copper binding. There is plenty of data in the literature, suggesting that Ni(II) affects post translational modifications, occuring naturally in histones, leading in gene silencing or over express. Additionally, formation of redox active Ni(II) complexes with parts of the protein, is able to produce ROS species that may damage DNA. On the other hand, since Cu(II) presents a richer redox chemistry than Ni(II), is able to produce ROS species in much higher quantity, when is in excess inside cells. However, when Cu(II) is bounded to peptide models of protamines and/or histones, may either have a protective effect, limiting the observed DNA damage, or enhance the formation of oxygen radicals, that could extensively harm DNA, protein and lipid molecules. In previous years, several studies have shown that H2A, H3 and H4 histones, may serve as efficient binding sites for metal ions, such as Cu(II) and Ni(II). On the contrary, histone H2B has not been extensively studied. However, there is evidence that Ni(II) ions may affect ubiquitination of histone H2B and promote oxidation in several parts of the protein molecule. In an attempt to investigate the role of metal binding on histone H2B, in the mechanisms of metal induced toxicity and/or carcinogenicity, we synthesized the peptides H2B32-62 and Η2Β94-125, that mimic the histone-fold domain and C-terminal of histone H2B protein, respectively, and studied their interaction with Ni(II) and Cu(II) ions. The peptides were synthesized on a Sieber amide resin, using Fmoc/t-Bu chemistry, the standard method for solid-phase peptide synthesis. The crude peptides were purified by gel filtration chromatography and semi-preparative high performance liquid chromatography on a reversed-phase support. The purity and identity was confirmed by means of ESI-MS and NMR. The interaction of the peptides with Ni(II) and Cu(II) ions was studied by means of Abstract 180 potentiometric titrations and several spectroscopic techniqes (UV-Vis, CD, EPR, NMR). The ability of the peptide metal complexes in inducing DNA double-strand breaks was studied with agarose gel electrophoresis, using the plasmid pUC19 as a target molecule. Due to the unexpected precipitation of the free ligand H2B32-62 over pH 7,8, we were not able to calculate the ionization constants of the Lys and Tyr residues. Precipitation was obvious, in all samples containing Ni(II) ions, suggesting that their interaction is not efficient. However, the oxidative behaviour of the systems H2B32-62/Ni(II)/H2O2 and Ni(II)/H2O2, concerning their ability in inducing DNA double strand breaks and plasmid degradation, is quite different. In the presence of the peptide H2B32-62 in the reaction mixtures, a decrease in the plasmid degradation with a concomitant increase in the appearance of double strand breaks, was evident. These facts can be explained due to the high affinity of this peptide for plasmid DNA, that may function as a protective layer on the plasmid. The increased incidence of double strand breaks may be explained by further oxidation of the peptide’s methionine sulfoxides to alkyl and peroxy-radicals. This proposal is in accordance with the fact that Ni(II) ions generate only single strand breaks. The complexation of the H2B32-62 peptide with Cu(II) ions is quite efficient. The precipitation that was observed in the free ligand solutions, was dissolved and several soluble Cu(II) complexes were detected in the pH range 4-10,5. At physiological pH, two major complexes are formed, where Cu(II) binds to the peptide in a 3N {NIm, 2N-} mode. The only difference between them, is that in one of them, the carboxylate group of the Asp20 binds in an axial position. Those complexes are redox active, since in their presence, degradation of the plasmid and increased incidence of double strand breaks was evident. The data presented in this thesis, suggest that binding of Cu(II) to this peptide sequence, might be involved in a carcinogenicity mechanism, arising from increased radical formation. Complexation of the peptide model H2B94-125 with Ni(II) ions starts at pH around 5, where a distorted octahedral complex is being formed...Είναι ευρέως τεκμηριωμένο ότι πολλά μεταλλικά ιόντα των στοιχείων μετάπτωσης, όπως το νικέλιο και ο χαλκός, είναι καρκινογόνα για τον άνθρωπο και άλλα θηλαστικά. Οι μοριακοί μηχανισμοί, με τους οποίους επιτυγχάνεται η καρκινογένεση από μεταλλικά ιόντα δεν είναι πλήρως κατανοητοί. Παρόλα αυτά, πιστεύεται ότι σχετίζεται με καταστροφή του DNA και/ή επιγενετικές μεταβολές που πηγάζουν από την δέσμευση των ιόντων στον πυρήνα του κυττάρου. Είναι γνωστό ότι τα ιόντα Ni(II), δεσμεύονται ασθενώς από τις φωσφορικές ομάδες του DNA και τα φωσφολιπίδια των κυτταρικών μεμβρανών. Για το λόγο αυτό, οι πυρηνικές πρωτεΐνες και πιο συγκεκριμένα οι ιστόνες, που απαντούν σε υψηλότερη συγκέντρωση εντός του πυρήνα, είναι οι κύριοι υποψήφιοι υποκαταστάτες για δέσμευση του μετάλλου. Αντίθετα, τα ιόντα Cu2+, δεσμέυονται ισχυρά τόσο με τις βάσεις του DNA, όσο και με πεπτιδικά μοντέλα ιστονών. Εντός του πυρήνα του κυττάρου, τα 2 αυτά συστατικά ανταγωνίζονται ως προς τη δέσμευση του μετάλλου. Υπάρχουν αρκετά στοιχεία που συνηγορούν στο γεγονός ότι το νικέλιο μπορεί να εμπλακεί στις χημικές τροποποιήσεις που λαμβάνουν χώρα φυσιολογικά στις ιστόνες και κατ’ αυτόν τον τρόπο να απορρυθμίσει την διαχείριση της γενετικής πληροφορίας. Επιπροσθέτως, η δημιουργία συμπλόκων του μετάλλου με τμήματα ιστονών που παρουσιάζουν αυξημένη οξειδοαναγωγική ικανότητα, μπορεί να προκαλέσει αυξημένη παραγωγή δραστικών ειδών οξυγόνου που δρούν απευθείας πάνω στο DNA. Ο χαλκός, δεδομένου ότι παρουσιάζει πιο πλούσια οξειδοαναγωγική χημεία από το νικέλιο, μπορεί να οδηγήσει άμεσα σε αυξημένη παραγωγή τέτοιων επιβλαβών προϊόντων, όταν βρίσκεται σε περίσσεια εντός του οργανισμού. Πάντως, όταν συμπλέκεται με ιστόνες ή προταμίνες μπορεί είτε να καταλύσει την δημιουργία τέτοιων ειδών, υποβοηθώντας την καταστροφή του DNA, είτε να δράσει προστατευτικά και να μειώσει την έκταση της οξειδωτικής βλάβης. Στη διεθνή βιβλιογραφία, υπάρχουν πολλές μελέτες αλληλεπίδρασης πεπτιδικών μοντέλων των πυρηνικών ιστονών Η3, Η4 και H2A, με Ni2+ και Cu2+. Αντίθετα, η ιστόνη H2B, δεν έχει μελετηθεί διεξοδικά, παρόλο που πρόσφατες έρευνες έχουν δείξει ότι το νικέλιο μπορεί να επιδράσει όχι μόνο στις χημικές τροποποιήσεις που λαμβάνουν χώρα σε αυτή, αλλά και να προκαλέσει οξείδωση σε διάφορα αμινοξικά κατάλοιπα της πρωτεΐνης. Προκειμένου να διερευνήσουμε τον ρόλο της ιστόνης Η2Β, στην τοξικότητα και καρκινογένεση που προκαλείται από Ni(II) και Cu(II), συνθέσαμε τα πεπτίδια Η2Β32-62 (SRKQSYSVYVYKVLKQVHPDTGISSKAMGIM) και Η2Β94-125 Περίληψη 176 (IQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK), τα οποία αποτελούν μοντέλα της ιστονικής πτύχωσης και C-τελικής ουράς της ιστόνης Η2Β, αντίστοιχα, και μελετήσαμε την αλληλεπίδραση τους με Ni(II) και Cu(II). Η πεπτιδική σύνθεση πραγματοποιήθηκε σε στερεή φάση με την Fmoc / tBu μεθοδολογία. Ο καθαρισμός των επιθυμητών πεπτιδικών προϊόντων, επιτεύχθηκε με χρωματογραφικές τεχνικές (gel filtration, RP-HPLC) και η ταυτοποίηση τους έγινε με φασματοσκοπία μάζας (ESI-MS) και φασματοσκοπία πυρηνικού μαγνητικού συντονισμού (NMR). Η αλληλεπίδραση των πεπτιδίων με Ni(II) και Cu(II), μελετήθηκε με ποτενσιομετρικές τιτλοδοτήσεις και διάφορες φασματοσκοπικές τεχνικές (UV-Vis, CD, EPR, NMR), ενώ η μελέτη της επίδρασης των συμπλόκων στην διάσπαση της διπλής έλικας του DNA, πραγματοποιήθηκε με ηλεκτροφόρηση σε αγαρόζη, χρησιμοποιώντας ως στόχο το πλασμίδιο pUC19. Η αναπάντεχη καταβύθιση του ελεύθερου πεπτιδίου Η2Β32-62, σε pH > 7,8 δεν επέτρεψε τον υπολογισμό των σταθερών ιονισμού των καταλοίπων Lys και Tyr. Η καταβύθιση ήταν εμφανής και στα διαλύματα που περιείχαν Ni(II), υποδηλώνοντας ότι το πεπτίδιο αυτό δεν συμπλέκεται αποτελεσματικά με τα ιόντα Ni(II). Εντούτοις, η μελέτη της οξειδωτικής συμπεριφοράς του συστήματος Η2Β32-62/Ni(II)/H2O2 είναι αρκετά διαφορετική από αυτή του συστήματος Ni(II)/H2O2, όσον αφορά την ικανότητα τους να προάγουν διάσπαση της διπλής έλικας και αποικοδόμηση του πλασμιδίου pUC19. Συγκεκριμένα, παρουσία του πεπτιδίου, παρατηρήθηκε ελάττωση στην αποικοδόμηση του πλασμιδιακού DNA σε μικρά τμήματα, με ταυτόχρονη όμως αύξηση στην συχνότητα διάσπασης της διπλής έλικας. Τα δύο αυτά φαινόμενα, αποδίδονται στην ισχυρή σύμπλεξη του πεπτιδίου με το πλασμιδιακό DNA, η οποία δημιουργεί ένα προστατευτικό στρώμα γύρω από αυτό. Όσον αφορά την αύξηση της συχνότητας εμφάνισης σχάσεων στην διπλή έλικα, αυτή αποδίδεται σε άλκυλο και περόξυ- ρίζες που δημιουργούνται από την περαιτέρω οξείδωση των σουλφοξειδίων μεθειονίνης του πεπτιδίου, δεδομένου ότι από την βιβλιογραφία είναι γνωστό ότι το Ni(II) προκαλεί διάσπαση μόνο της μιας έλικας..

Kinetics and Mechanisms of the Chromium(III) Reactions with 2,4-and 2,5-Dihydroxybenzoic Acids in Weak Acidic Aqueous Solutions

The reactions of 2,4-and 2,5-dihydroxybenzoic acids (dihydroxybenzoic acid, DHBA) with chromium(III) in weak acidic aqueous solutions have been shown to take place in at least two stages. The first stage of the reactions has an observed rate constan