3,795 research outputs found
Effect of shear heat on hydrodynamic lift of brush seals in oil sealing
Importance of hydrodynamic lift clearance has been stated in previous studies [1, 2, 3]. At those studies, derivation of closed form function for oil temperature has been performed and the shear heat dissipation effect has been successfully integrated into the lift force formulation. Oil pressure is successfully derived by tracking three different ways, all of which give very similar results to each other. All these analyses are advanced fluid mechanics and heat transfer analyses, which give consistent results with real-life applications. In this study, function of shear heating effect included in hydrodynamic lift clearance formulation. For a different pressure loads (which is a design parameter and known), change of hydrodynamic lift clearance
with rotor surface speed can be found without requiring any experimental leakage data. Furthermore, theoretic lift clearance has consistency with the experimental lift data
A note on the influence of Friedrich Nietzsche on the economic thought of Joseph A. Schumpeter
Joseph A. Schumpeter (1883-1950) tarafından eserlerinde ortaya konulan en özgün ve iddialı fikir, bir kahramanın, yaratıcı girişimcinin, dinamik iktisadî yapının öncüsü olmasıdır. Bu mükemmel insan iktisadın üretici güçlerine yeni olanaklar sağlamaktadır. Bu bağlamda, Nietzsche'nin görüşlerinin Schumpeter'inkiler ile çok sayıda benzerliği vardır. Diğer taraftan, Schumpeter'in vizyonunda Nietzsche'nin tanımladığı anlamda bir yaratıcı unsur da bulunmaktadır. Zamanla bu unsur, iktisadî olgunun gerçek doğasını anlamaya yönelik, daha tutarlı analitik bir önermeye dönüşmüştür. Dolayısıyla, Schumpeter'in girişimcinin önem yitirmesi veya kapitalizmin çöküşü gibi bazı analitik önermelerine, test edilemeyen karakterlerine rağmen, rasyonelleştirilmeleri kaydıyla hoşgörü gösterilebilir.The more original and provocative these which Joseph A. Schumpeter (1883-1950) developed in his work is that an heroic individual, the creative entrepreneur is the innovator of the dynamic economic system. This is the greatest personality who introduces new abilities to the productive forces of the economy. In this context, Nietzsche's thoughts have many similarities with those of Schumpeter's. On the other hand, there is a Nietzschean creative element in the vision of Schumpeter. As time passed, this element has been transformed into a more coherent analytical proposition to understand the very nature of the economic phenomenon. Despite the untestable character of some Schumpeterian analytical propositions, like the obsolescence of the entrepreneur or the danger of the decline of capitalism, we could have tolerance towards them in a rationally justified manner
Amerika'da İtalyan yemeği yaparak tepelere tırmanan Türkiyeli:Erdoğan Doğu
Taha Toros Arşivi, Dosya No: 112-Lokantalarİstanbul Kalkınma Ajansı (TR10/14/YEN/0033) İstanbul Development Agency (TR10/14/YEN/0033
In silico characterization of boron transporter (BOR1) protein sequences in Poaceae species
Boron (B) is essential for the plant growth and development, and its primary function is connected with formation of the cell wall. Moreover, boron toxicity is a shared problem in semiarid and arid regions. In this study, boron transporter protein (BOR1) sequences from some Poaceae species (Hordeum vulgare subsp. vulgare, Zea mays, Brachypodium distachyon, Oryza sativa subsp. japonica, Oryza sativa subsp. indica, Sorghum bicolor, Triticum aestivum) were evaluated by bioinformatics tools. Physicochemical analyses revealed that most of BOR1 proteins were basic character and had generally aliphatic amino acids. Analysis of the domains showed that transmembrane domains were identified constantly and three motifs were detected with 50 amino acids length. Also, the motif SPNPWEPGSYDHWTVAKDMFNVPPAYIFGAFIPATMVAGLYYFDHSVASQ was found most frequently with 25 repeats. The phylogenetic tree showed divergence into two main clusters. B. distachyon species were clustered separately. Finally, this study contributes to the new BOR1 protein characterization in grasses and create scientific base for in silico analysis in future
Bu oyuna dikkat
Taha Toros Arşivi, Dosya No: 77/A-Ermeniler.
Not: Gazetenin “Ankara'dan” köşesinde yayımlanmıştır.İstanbul Kalkınma Ajansı (TR10/14/YEN/0033) İstanbul Development Agency (TR10/14/YEN/0033
Vasfi Rıza Zobu
Taha Toros Arşivi, Dosya No: 152-Vasfi Rıza Zobu. Not: Makale ekli dokümanın 15.sayfasında bulunmaktadır.İstanbul Kalkınma Ajansı (TR10/14/YEN/0033) İstanbul Development Agency (TR10/14/YEN/0033
The attitude of public opinion and the evolution process of Turkey and the Europe Union (EU) relationships
Son yıllarda Türkiye-AB ilişkileri kamuoyunda sıkça tartışılmaktadır. İlişkilerin sürecine paralel olarak bu tartışmalar bazen olumlu bazen de olumsuz yönde olmaktadır. Kamuoyunun konu ile ilgisi bazı dönemler de yoğunlaşmış ve gündemde yer almıştır. Bu dönemler; 1963 yılında taraflar arasında imzalan Ankara Antlaşması ve sonraki dönem, 1987 yılındaki Türkiye'nin Avrupa Ekonomik Topluluğu'na (AET) tam üyelik müracaatı, 1995 yılında taraflar arsında imzalanan Gümrük Birliği (GB), 1999 yılında Türkiye'nin tam aday ülke konumuna getirildiği Helsinki Zirvesi'dir. Türkiye'nin 2004'te tam üyelik müzakereleri için bir tarih alması, 2005 Ekim'inde tam üyelik müzakerelerine başlaması ve sonrası kamuoyu için yeni bir dönemin başlangıcını oluşturmuştur. Bu dönemlerde kamuoyunda yer alan Türkiye-AB ilişkileri günümüzde gelişen kitle iletişim araçları ile daha fazla tartışılmakta ve hemen her kesimin ilgisini çekmektedir. Son günlerde Kıbrıs sorunu, ermeni soykırımı iddiaları, ana dilde eğitim ve yayın hakkı gibi bazı konular AB ile ilişkiler paralelinde Türkiye gündeminden hiç düşmemektedir.Turkey and EU relationships have been discussed in public opinion recently. These discussion have been sometimes antagonist and sometimes constructive according to the process of the relationships. The interest of public opinion in this subject has been intensive in particular times and put on the agenda. These particular times; Ankara Pact, signed in 1963, and afterwards, the application of Turkey for membership to Europe Economic Community (EEC) in 1987, Custom Union (CU), signed in 1995, and Helsinki Submit, where Turkey has become a candidate country for EU full membership. For Turkey is began a form new why are the full candidate of Turkey to EU in 2004 and the full membership consultation of Turkey to EU in 2005. The relationships between Turkey and EU in public opinion in these periods discussed more and attract the interest of all public now. At last days, as some matters that Cyprus problem, assertions for Armenia genocide, primitive language education and publication right has been put on agenda of Turkey
Adı fakir, ruhu zengin
Taha Toros Arşivi, Dosya No: 95-Fakir Baykurt.
Not: Gazetenin “Politika” köşesinde yayımlanmıştır.Unutma İstanbul projesi İstanbul Kalkınma Ajansı'nın 2016 yılı "Yenilikçi ve Yaratıcı İstanbul Mali Destek Programı" kapsamında desteklenmiştir. Proje No: TR10/16/YNY/010
The phenomenon of the urban - rural migration in Turkey
Bu çalışmada Türkiye’de kentten köye göç olgusunun, nedenleri ve sonuçları değerlendirilmiştir. Kentten köye göç, köyden kente göç ile birlikte ele alınarak aralarındaki ilişki tespit edilmiştir. Çalışmada, Türkiye’de kentten köye göçün, toplumsal gelişmelerin önemli bir sonucu olduğu gerçeği ön plana çıkarılmıştır.In this study, causes and results of the urban-rural migration phenomena were evaluated. The relationship between urban-rural migration and rural-urban migration were determined taking them simultaneously. The significant result of study was that that the urban-rural migration stemmed from social changes taking part in Turkey
- …