Planificación de la implementación de estrategias de enseñanza innovadoras de los contenidos curriculares de la asignatura Biología del Ciclo Básico de la Facultad de Ciencias Exactas

El presente trabajo pretende elaborar un diseño para implementar estrategias innovadoras en la enseñanza de los contenidos curriculares de Biología, con el objeto de minimizar el impacto que genera en los estudiantes atravesar los primeros años de la universidad. La Asignatura se dicta en el 2° año dentro del Ciclo Básico común a todas las Carreras de la Facultad de Ciencias Exactas de la UNLP. Los alumnos que ya han transitado su primer año universitario, al siguiente año, demuestran que no han adquirido aún el oficio de un estudiante universitario; por ello la autora asume que poseen características compatibles con alumnos “noveles” y/o “ingresantes”. Estrategias trabajadas exitosamente en un Proyecto de Extensión dirigido a estudiantes secundarios, se implementaron en la cátedra pero no cumplieron con las expectativas. Por lo expuesto, se buscaron nuevas estrategias y surgió un listado que contenía las más promisorias, las cuales fueron implementadas en simultáneo con las anteriores durante las clases taller de Biología. Mediante el análisis comparativo de estas herramientas ensayadas en ambos ámbitos (proyecto de extensión y curso universitario), se escogieron las más valoradas por los estudiantes y por los docentes implicados en esta tarea. Dicha selección se complementará con otras estrategias y, el conjunto de ellas, será el que se propone implementar en este proyecto en una comisión de innovación. Se espera incrementar las competencias requeridas para el buen desempeño no sólo en Biología sino en la carrera y, de ese modo, contribuir a mejorar las posibilidades de permanencia de los estudiantes.Facultad de Ciencias Exacta

Planificación de la implementación de estrategias de enseñanza innovadoras de los contenidos curriculares de la asignatura Biología del Ciclo Básico de la Facultad de Ciencias Exactas

El presente trabajo pretende elaborar un diseño para implementar estrategias innovadoras en la enseñanza de los contenidos curriculares de Biología, con el objeto de minimizar el impacto que genera en los estudiantes atravesar los primeros años de la universidad. La Asignatura se dicta en el 2° año dentro del Ciclo Básico común a todas las Carreras de la Facultad de Ciencias Exactas de la UNLP. Los alumnos que ya han transitado su primer año universitario, al siguiente año, demuestran que no han adquirido aún el oficio de un estudiante universitario; por ello la autora asume que poseen características compatibles con alumnos “noveles” y/o “ingresantes”. Estrategias trabajadas exitosamente en un Proyecto de Extensión dirigido a estudiantes secundarios, se implementaron en la cátedra pero no cumplieron con las expectativas. Por lo expuesto, se buscaron nuevas estrategias y surgió un listado que contenía las más promisorias, las cuales fueron implementadas en simultáneo con las anteriores durante las clases taller de Biología. Mediante el análisis comparativo de estas herramientas ensayadas en ambos ámbitos (proyecto de extensión y curso universitario), se escogieron las más valoradas por los estudiantes y por los docentes implicados en esta tarea. Dicha selección se complementará con otras estrategias y, el conjunto de ellas, será el que se propone implementar en este proyecto en una comisión de innovación. Se espera incrementar las competencias requeridas para el buen desempeño no sólo en Biología sino en la carrera y, de ese modo, contribuir a mejorar las posibilidades de permanencia de los estudiantes.Facultad de Ciencias Exacta

Effect of laundry detergent formulation on the performance of alkaline phytoproteases

Background: Proteases constitute the largest product segment in the global industrial enzymes market; they are used in food, pharmaceutical, leather, textile, wood and detergent industries. Alkaline proteases improve the cleaning efficiency of detergents and represent one of the most successful applications of modern industrial biotechnology. The aim of this work was to study the performance of two alkaline phytoproteases, araujiain (Araujia hortorum Fourn.) and asclepain (Asclepias curassavica L.), for their potential application as additive in laundry detergent formulations. Results: The effect of pure non-ionic and ionic surfactants on proteolytic activity of araujiain and asclepain was analyzed measuring the remaining activity after 1 hr of incubation of those enzymes in aqueous solutions of surfactants at different concentrations (0.1, 0.4 and 1% v/v) and temperatures (25, 40 and 60oC). Besides, the compatibility of the enzymes with six commercial laundry detergents was also studied measuring the remaining proteolytic activity at 37oC after 1 hr. Commercial detergent components influenced in different ways on araujiain and asclepain, in spite of the similar behaviour of the two enzymes in buffer. In commercial detergent solutions, araujiain expressed between 60% and 140% of its remaining proteolytic activity in buffer (pH 8.5) at 37oC after 1 hr, while asclepain, was practically inactivate in most of them at the same conditions. Conclusions: Proteolytic extract of Araujia hortorum fulfilled all the requirements for its application as additive for laundry detergents: high stability in a broad temperature range (25-70oC), high activity in alkaline pH (7.5-9.5) and very good compatibility with the commercial detergent additives. Nevertheless, in spite of its high stability and activity in buffer, the proteolytic extract of Asclepias curassavica did not show the same performance than araujiain.Centro de Investigación de Proteínas Vegetale

Characterization of the fruit proteolytic system of Bromelia serra Griseb. (Bromeliaceae) and its application in bioactive peptides release

A crude extract with proteolytic activity was prepared from edible fruits of Bromelia serra, containing cysteine peptidases with molecular masses between 24.1 and 25.9 kDa. The extract presented an optimal pH range of 6.03‒9.05, retained more than 80% of activity after thermal pre-treatments at 23, 37, and 45°C (120 min), but it was rapidly inactivated after 10 min at 75°C. These proteases were employed to hydrolyze soybean proteins, bovine casein and bovine whey, achieving degrees of hydrolysis of 18.3 ± 0.6, 29.1 ± 0.7, and 12.6 ± 0.9% (55°C, 180 min), respectively. The casein 180 min-hydrolysate (55°C) presented the maximum value of antioxidant activity (2.89 ± 0.12 mg/mL Trolox), and the whey protein 180 min-hydrolysate (55°C) showed the highest percentage of angiotensin-converting enzyme inhibition (91.9 ± 1.2%). This low-cost enzymatic preparation would be promising for the food industry because it requires mild working conditions and yields hydrolysates with biological activities useful as ingredients for functional food. Practical application: Proteolytic enzymes are employed in the food industry in a wide variety of processes since they modify the properties of proteins causing beneficial effects such as improvement digestibility, diminution of allergenicity, and release of bioactive peptides. Fruits from Bromelia serra possess cysteine peptidases that could be used in food biotechnology because they are capable to hydrolyze soybean and milk proteins by mild working conditions and to provoke the release of bioactive peptides. These hydrolysates containing antioxidative and ACE-inhibitor activities would be useful as ingredients for functional foods or as nutraceuticals, which are nowadays two products highly required by consumers.Fil: Salese, Lucía. Universidad Nacional de La Plata. Facultad de Ciencias Exactas. Departamento de Ciencias Biológicas. Laboratorio de Investigación de Proteínas Vegetales; Argentina. Consejo Nacional de Investigaciones Científicas y Técnicas. Centro Científico Tecnológico Conicet - La Plata; ArgentinaFil: Liggieri, Constanza Silvina. Provincia de Buenos Aires. Gobernación. Comisión de Investigaciones Científicas; Argentina. Universidad Nacional de La Plata. Facultad de Ciencias Exactas. Departamento de Ciencias Biológicas. Laboratorio de Investigación de Proteínas Vegetales; ArgentinaFil: Bernik, Delia Leticia. Universidad Nacional de La Plata. Facultad de Ciencias Exactas. Departamento de Ciencias Biológicas. Laboratorio de Investigación de Proteínas Vegetales; Argentina. Consejo Nacional de Investigaciones Científicas y Técnicas. Centro Científico Tecnológico Conicet - La Plata; ArgentinaFil: Bruno, Mariela Anahí. Universidad Nacional de La Plata. Facultad de Ciencias Exactas. Departamento de Ciencias Biológicas. Laboratorio de Investigación de Proteínas Vegetales; Argentina. Consejo Nacional de Investigaciones Científicas y Técnicas. Centro Científico Tecnológico Conicet - La Plata; Argentin

Peptidasas aspárticas de flores de Asteraceae con potencial aplicación biotecnológica

En las últimas décadas el interés por las peptidasas se ha incrementado significativamente. La gran mayoría de las enzimas comerciales que se emplean se obtienen principalmente de microorganismos. Sin embargo, también pueden ser extraídas de especies vegetales que se presentan como una fuente promisoria de estas moléculas. De hecho, las peptidasas vegetales son ampliamente utilizadas en la industria alimentaria, farmacéutica, biotecnológica y de detergentes, y son candidatas atractivas para el desarrollo de nuevos fármacos y en terapias combinadas. Están ampliamente distribuidas en los organismos vivos. Típicamente presentan un prodominio autoinhibitorio, que debe ser eliminado para activar la enzima. Si bien todas llevan a cabo la misma reacción que consiste en la hidrólisis de los enlaces peptídicos de las proteínas, difieren sin embargo, en la especificidad de sustrato, pH óptimo, la temperatura y otros parámetros que hacen que sus propiedades sean únicas, mostrando una gran diversidad funcional. Dentro de estas moléculas, las peptidasas aspárticas (PAs), constituyen una de las principales clases de peptidasas. Las flores de cardo (familia Asteraceae) son una fuente rica de PAs. Con el fin de asegurar una fuente continua de dichas enzimas, las mismas pueden ser obtenidas de su fuente natural o por métodos recombinantes. Debido a sus propiedades características se emplean en diversos procesos industriales. Ejemplos de aplicaciones tradicionales de estas peptidasas como fabricación de queso así como otras aplicaciones promisorias como la obtención de péptidos bioactivos con actividad antimicrobiana y citotóxica, acción en la remodelación de la matriz extracelular, inmovilización en esponjas de quitosano, catalizadores en medios orgánicos son discutidas en esta revisión.The interest in peptidase has increased significantly in recent decades. The vast majority of commercial enzymes used in industry are mainly obtained from microorganisms. However, they can also be extracted from plant species that are considered as a promising source of these molecules. In fact, plant peptidases are widely used in the food, detergent, pharmaceutical and biotechnological industry, and are attractive candidates for the development of new drugs and in combination therapies. They are widely distributed in living organisms. Typically they have a self-inhibitory prodomain, which must be removed to activate the enzyme. While all peptidases carried out the same reaction, the hydrolysis of protein peptide bonds, they differ in substrate specificity, optimum pH and temperature as well as in other parameters that make their properties unique, showing a great functional diversity. Among these molecules, aspartic peptidases (APs) are one of the major classes of proteolytic enzymes. Thistle flowers (family Asteraceae) are a rich source of APs. In order to ensure a continuous supply of Aps from flowers, they can be obtained from its natural source or by recombinant methods. Because of their distinctive properties Aps from thistle flowers are used in various industrial processes. Cheese-making is an example of traditional use of thistle APs, but also other promising applications such as production of bioactive peptides with antimicrobial and cytotoxic activity, remodelling of bone extracellular matrix, immobilization in chitosan sponges for drug delivery, and catalysis in organic media are discussed in this review

Effect of laundry detergent formulation on the performance of alkaline phytoproteases

Background: Proteases constitute the largest product segment in the global industrial enzymes market; they are used in food, pharmaceutical, leather, textile, wood and detergent industries. Alkaline proteases improve the cleaning efficiency of detergents and represent one of the most successful applications of modern industrial biotechnology. The aim of this work was to study the performance of two alkaline phytoproteases, araujiain (Araujia hortorum Fourn.) and asclepain (Asclepias curassavica L.), for their potential application as additive in laundry detergent formulations. Results: The effect of pure non-ionic and ionic surfactants on proteolytic activity of araujiain and asclepain was analyzed measuring the remaining activity after 1 hr of incubation of those enzymes in aqueous solutions of surfactants at different concentrations (0.1, 0.4 and 1% v/v) and temperatures (25, 40 and 60oC). Besides, the compatibility of the enzymes with six commercial laundry detergents was also studied measuring the remaining proteolytic activity at 37oC after 1 hr. Commercial detergent components influenced in different ways on araujiain and asclepain, in spite of the similar behaviour of the two enzymes in buffer. In commercial detergent solutions, araujiain expressed between 60% and 140% of its remaining proteolytic activity in buffer (pH 8.5) at 37oC after 1 hr, while asclepain, was practically inactivate in most of them at the same conditions. Conclusions: Proteolytic extract of Araujia hortorum fulfilled all the requirements for its application as additive for laundry detergents: high stability in a broad temperature range (25-70oC), high activity in alkaline pH (7.5-9.5) and very good compatibility with the commercial detergent additives. Nevertheless, in spite of its high stability and activity in buffer, the proteolytic extract of Asclepias curassavica did not show the same performance than araujiain.Centro de Investigación de Proteínas Vegetale

Aspartic peptidases from flowers of Asteraceae with potential biotechnological application

En las últimas décadas el interés por las peptidasas se ha incrementado significativamente. La gran mayoría de las enzimas comerciales que se emplean se obtienen principalmente de microorganismos. Sin embargo, también pueden ser extraídas de especies vegetales que se presentan como una fuente promisoria de estas moléculas. De hecho, las peptidasas vegetales son ampliamente utilizadas en la industria alimentaria, farmacéutica, biotecnológica y de detergentes, y son candidatas atractivas para el desarrollo de nuevos fármacos y en terapias combinadas. Están ampliamente distribuidas en los organismos vivos. Típicamente presentan un prodominio autoinhibitorio, que debe ser eliminado para activar la enzima. Si bien todas llevan a cabo la misma reacción que consiste en la hidrólisis de los enlaces peptídicos de las proteínas, difieren sin embargo, en la especificidad de sustrato, pH óptimo, la temperatura y otros parámetros que hacen que sus propiedades sean únicas, mostrando una gran diversidad funcional. Dentro de estas moléculas, las peptidasas aspárticas (PAs), constituyen una de las principales clases de peptidasas. Las flores de cardo (familia Asteraceae) son una fuente rica de PAs. Con el fin de asegurar una fuente continua de dichas enzimas, las mismas pueden ser obtenidas de su fuente natural o por métodos recombinantes. Debido a sus propiedades características se emplean en diversos procesos industriales. Ejemplos de aplicaciones tradicionales de estas peptidasas como fabricación de queso así como otras aplicaciones promisorias como la obtención de péptidos bioactivos con actividad antimicrobiana y citotóxica, acción en la remodelación de la matriz extracelular, inmovilización en esponjas de quitosano, catalizadores en medios orgánicos son discutidas en esta revisión.The interest in peptidase has increased significantly in recent decades. The vast majority of commercial enzymes used in industry are mainly obtained from microorganisms. However, they can also be extracted from plant species that are considered as a promising source of these molecules. In fact, plant peptidases are widely used in the food, detergent, pharmaceutical and biotechnological industry, and are attractive candidates for the development of new drugs and in combination therapies. They are widely distributed in living organisms. Typically they have a self-inhibitory prodomain, which must be removed to activate the enzyme. While all peptidases carried out the same reaction, the hydrolysis of protein peptide bonds, they differ in substrate specificity, optimum pH and temperature as well as in other parameters that make their properties unique, showing a great functional diversity. Among these molecules, aspartic peptidases (APs) are one of the major classes of proteolytic enzymes. Thistle flowers (family Asteraceae) are a rich source of APs. In order to ensure a continuous supply of Aps from flowers, they can be obtained from its natural source or by recombinant methods. Because of their distinctive properties Aps from thistle flowers are used in various industrial processes. Cheese-making is an example of traditional use of thistle APs, but also other promising applications such as production of bioactive peptides with antimicrobial and cytotoxic activity, remodelling of bone extracellular matrix, immobilization in chitosan sponges for drug delivery, and catalysis in organic media are discussed in this review.Facultad de Ciencias Exacta

Preparation of soy protein hydrolysates with antioxidant activity by using peptidases from latex of Maclura pomifera fruits

A partially purified proteolytic extract prepared from Maclura pomifera latex was employed in hydrolyzing a soybean-protein isolate (4.2 mg/mL). The hydrolysis-product formation, monitored by tricine–sodium-dodecyl-sulfate–polyacrylamyde-gel electrophoresis and reverse-phase high-performance liquid chromatography, indicated that after 10 min of reaction the main soybean proteins disappeared. The maximum degree of hydrolysis was 36.2% after a 180-min digestion. The 90-min hydrolysate presented an IC50 of 31.6 ± 0.2 µg/mL, and a trolox equivalent antioxidant capacity of 157.6 and 176.9 µmoles TE per g of peptide determined by two different methods. Analysis by matrix-assisted–laser-desorption-ionization–time-of-flight mass spectrometry (MALDI-TOF MS), followed by the application of bioinformatics tools, enabled the deduction of fourteen theoretical peptide sequences containing antioxidant amino acids at >60%, none of which sequences had been previously reported as antioxidants. Finally, we consider that this 90-min hydrolysate would constitute a promising ingredient in the manufacture of functional foods.Instituto de Fisiología VegetalCentro de Investigación de Proteínas Vegetale

Biochemical analysis of a papain-like protease isolated from the latex of Asclepias curassavica L.

Most of the species belonging to Asclepiadaceae family usually secrete an endogenous milk-like fluid in a network of laticifer cells in which sub-cellular organelles intensively synthesize proteins and secondary metabolites. A new papain-like endopeptidase (asclepain cII) has been isolated and characterized from the latex extracted from petioles of Asclepias curassavica L. (Asclepiadaceae). Asclepain cII was the minor proteolytic component in the latex, but showed higher specific activity than asclepain cI, the main active fraction previously studied. Both enzymes displayed quite distinct biochemical characteristics, confirming that they are different enzymes. Crude extract was purified by cation exchange chromatography (FPLC). Two active fractions, homogeneous by sodium dodecyl sulphate-polyacrylamide gel electrophoresis and mass spectrometry, were isolated. Asclepain cII displayed a molecular mass of 23,590 Da, a pI higher than 9.3, maximum proteolytic activity at pH 9.4-10.2, and showed poor thermostability. The activity of asclepain cII is inhibited by cysteine proteases inhibitors like E-64, but not by any other protease inhibitors such as 1,10-phenantroline, phenylmethanesulfonyl fluoride, and pepstatine. The N-terminal sequence (LPSFVDWRQKGVVFPIRNQGQCGSCWTFSA) showed a high similarity with those of other plant cysteine proteinases. When assayed on N-α-CBZ-amino acid-p-nitrophenyl esters, the enzyme exhibited higher preference for the glutamine derivative. Determinations of kinetic parameters were performed with N-α-CBZ-l-Gln-p-nitrophenyl ester as substrate: Km = 0.1634 mM, kcat = 121.48 s-1, and kcat/Km = 7.4 × 105 s-1/mM.Centro de Investigación de Proteínas VegetalesFacultad de Ciencias Exacta

Aspartic peptidases from flowers of Asteraceae with potential biotechnological application

En las últimas décadas el interés por las peptidasas se ha incrementado significativamente. La gran mayoría de las enzimas comerciales que se emplean se obtienen principalmente de microorganismos. Sin embargo, también pueden ser extraídas de especies vegetales que se presentan como una fuente promisoria de estas moléculas. De hecho, las peptidasas vegetales son ampliamente utilizadas en la industria alimentaria, farmacéutica, biotecnológica y de detergentes, y son candidatas atractivas para el desarrollo de nuevos fármacos y en terapias combinadas. Están ampliamente distribuidas en los organismos vivos. Típicamente presentan un prodominio autoinhibitorio, que debe ser eliminado para activar la enzima. Si bien todas llevan a cabo la misma reacción que consiste en la hidrólisis de los enlaces peptídicos de las proteínas, difieren sin embargo, en la especificidad de sustrato, pH óptimo, la temperatura y otros parámetros que hacen que sus propiedades sean únicas, mostrando una gran diversidad funcional. Dentro de estas moléculas, las peptidasas aspárticas (PAs), constituyen una de las principales clases de peptidasas. Las flores de cardo (familia Asteraceae) son una fuente rica de PAs. Con el fin de asegurar una fuente continua de dichas enzimas, las mismas pueden ser obtenidas de su fuente natural o por métodos recombinantes. Debido a sus propiedades características se emplean en diversos procesos industriales. Ejemplos de aplicaciones tradicionales de estas peptidasas como fabricación de queso así como otras aplicaciones promisorias como la obtención de péptidos bioactivos con actividad antimicrobiana y citotóxica, acción en la remodelación de la matriz extracelular, inmovilización en esponjas de quitosano, catalizadores en medios orgánicos son discutidas en esta revisión.The interest in peptidase has increased significantly in recent decades. The vast majority of commercial enzymes used in industry are mainly obtained from microorganisms. However, they can also be extracted from plant species that are considered as a promising source of these molecules. In fact, plant peptidases are widely used in the food, detergent, pharmaceutical and biotechnological industry, and are attractive candidates for the development of new drugs and in combination therapies. They are widely distributed in living organisms. Typically they have a self-inhibitory prodomain, which must be removed to activate the enzyme. While all peptidases carried out the same reaction, the hydrolysis of protein peptide bonds, they differ in substrate specificity, optimum pH and temperature as well as in other parameters that make their properties unique, showing a great functional diversity. Among these molecules, aspartic peptidases (APs) are one of the major classes of proteolytic enzymes. Thistle flowers (family Asteraceae) are a rich source of APs. In order to ensure a continuous supply of Aps from flowers, they can be obtained from its natural source or by recombinant methods. Because of their distinctive properties Aps from thistle flowers are used in various industrial processes. Cheese-making is an example of traditional use of thistle APs, but also other promising applications such as production of bioactive peptides with antimicrobial and cytotoxic activity, remodelling of bone extracellular matrix, immobilization in chitosan sponges for drug delivery, and catalysis in organic media are discussed in this review.Facultad de Ciencias Exacta