Hidrolasas de látex de especies del género Araujia : Purificación y caracterización de las enzimas proteolíticas

Muchas plantas contienen látex, que es exudado cuando las mismas son dañadas, habiéndose detectado un considerable número de proteínas presentes en esta secreción. Sin embargo el rol de estas proteínas, entre las cuales hay varias enzimas, es aún motivo de especulación entre los fisiólogos vegetales. En un buen número de casos el látex contiene proteasas, a veces en cantidades tan elevadas que han dado lugar a su aprovechamiento biotecnológico (papaína, ficina). En un trabajo reciente (Konno et al., 2004) parece haber quedado demostrado que algunas proteasas juegan un importante papel en la defensa de la planta frente al ataque de insectos fitófagos. De todos modos este hecho no parece estar generalizado, ya que el látex de muchas plantas parece no contener proteasas, o al menos no contenerlas en su forma biológica activa, si se atiende a la información bibliográfica existente. Por otra parte la presencia de tejidos laticíferos tampoco es una constante en las plantas, sino que por el contrario está limitada a algunos grupos taxonómicos, siendo característica su presencia en las familias Caricaceae, Moraceae, Euphorbiaceae, Apocynaceae y Asclepiadaceae, entre otras. En base a esta información y a la experiencia existente en el LIProVe en el aislamiento de fitoproteasas presentes en laticíferos, se decidió analizar el contenido de este tipo de enzimas en dos especies que crecen en la zona: Araujia angustifolia (Hook et Arn.) Decaisne y A. hortorum Fourn (Asclepiadaceae).Facultad de Ciencias Exacta

A Highly Stable Biocatalyst Obtained from Covalent Immobilization of a Non-Commercial Cysteine Phytoprotease

In this work, araujiain (enzymatic preparation obtained from the latex of Araujia hortorum fruits) was successfully immobilized on glyoxyl-agarose via multipoint covalent attachment. Thus, good efficiency of immobilization and high operational stability of immobilized enzyme were obtained. The activity of araujiain at alkaline pH was significantly improved after immobilization. In addition, immobilized araujiain also showed high activity and good stability, without significant loss in its activity, at temperatures between 37 and 60°C and in the presence of immiscible organic solvents. Immobilized araujiain also showed good performance in a mixture of 50% ethyl acetate in buffer, used for peptide synthesis, with better results than when the free enzyme was used as catalyst. These results indicate that immobilized araujiain via multipoint covalent attachment can be highly stabilized and this method might be used for practical applications of araujiain in hydrolytic and synthetic processes.Centro de Investigación de Proteínas Vegetale

A Highly Stable Biocatalyst Obtained from Covalent Immobilization of a Non-Commercial Cysteine Phytoprotease

In this work, araujiain (enzymatic preparation obtained from the latex of Araujia hortorum fruits) was successfully immobilized on glyoxyl-agarose via multipoint covalent attachment. Thus, good efficiency of immobilization and high operational stability of immobilized enzyme were obtained. The activity of araujiain at alkaline pH was significantly improved after immobilization. In addition, immobilized araujiain also showed high activity and good stability, without significant loss in its activity, at temperatures between 37 and 60°C and in the presence of immiscible organic solvents. Immobilized araujiain also showed good performance in a mixture of 50% ethyl acetate in buffer, used for peptide synthesis, with better results than when the free enzyme was used as catalyst. These results indicate that immobilized araujiain via multipoint covalent attachment can be highly stabilized and this method might be used for practical applications of araujiain in hydrolytic and synthetic processes.Centro de Investigación de Proteínas Vegetale

Purificación y caracterización parcial del primer inhibidor de carboxipeptidasa aislado de pimiento amarillo (capsicum annuum L.)

Si bien los inhibidores de proteasas han sido considerados por mucho tiempo como factores anti-nutricionales; estudios recientes han demostrado la capacidad de estas moléculas de resistir el proceso gastrointestinal, atravesar el tracto digestivo y llegar a la sangre de manera intacta. De este modo, podrían ejercer su actividad biológica en sangre y tejidos periféricos como moléculas anticancerígenas, antitrombóticas, antimaláricas y antiangiogénicas, entre otras. Varias de estas actividades biológicas han sido descritas para los inhibidores de metalocarboxipeptidasas (IMCP). Los IMCPs están escasamente investigados en el reino vegetal, la mayoría de ellos pertenece a la familia Solanaceae y poseen características estructurales especiales que les proporcionan una extrema estabilidad biofisicoquímica. En este trabajo reportamos el aislamiento y purificación parcial del primer IMCP aislado de Capsicum annuum al que denominamos YBPCI. El extracto crudo fue parcialmente purificado mediante tratamiento térmico a 100 ºC y posterior cromatografía de afinidad empleando Carboxipeptidasa A inmovilizada en glioxil-agarosa. Los pasos de purificación fueron evaluados mediante el estudio del perfil proteico por SDS-PAGE y cuantificación proteica. El YBPCI presentó un peso molecular de 4 060 Da (valor obtenido mediante espectrometría de masas MALDI-TOF) y una I0.5 de 0.4 µg ml-1. Además, demostramos la estabilidad a la temperatura, fuerza salina y a valores extremos de pH, realizando finalmente un ensayo de simulación gástrica in-vitro y comprobando que el YBPCI mantiene su actividad inhibitoria intacta. Estos resultados alientan el estudio de su potencial actividad biológica, con el fin de emplear dicha molécula como potencial aditivo natural de alimentos, explotando así su capacidad conservante.Universidad Nacional de La Plat

Purificación y caracterización parcial del primer inhibidor de carboxipeptidasa aislado de pimiento amarillo (capsicum annuum L.)

Si bien los inhibidores de proteasas han sido considerados por mucho tiempo como factores anti-nutricionales; estudios recientes han demostrado la capacidad de estas moléculas de resistir el proceso gastrointestinal, atravesar el tracto digestivo y llegar a la sangre de manera intacta. De este modo, podrían ejercer su actividad biológica en sangre y tejidos periféricos como moléculas anticancerígenas, antitrombóticas, antimaláricas y antiangiogénicas, entre otras. Varias de estas actividades biológicas han sido descritas para los inhibidores de metalocarboxipeptidasas (IMCP). Los IMCPs están escasamente investigados en el reino vegetal, la mayoría de ellos pertenece a la familia Solanaceae y poseen características estructurales especiales que les proporcionan una extrema estabilidad biofisicoquímica. En este trabajo reportamos el aislamiento y purificación parcial del primer IMCP aislado de Capsicum annuum al que denominamos YBPCI. El extracto crudo fue parcialmente purificado mediante tratamiento térmico a 100 ºC y posterior cromatografía de afinidad empleando Carboxipeptidasa A inmovilizada en glioxil-agarosa. Los pasos de purificación fueron evaluados mediante el estudio del perfil proteico por SDS-PAGE y cuantificación proteica. El YBPCI presentó un peso molecular de 4 060 Da (valor obtenido mediante espectrometría de masas MALDI-TOF) y una I0.5 de 0.4 µg ml-1. Además, demostramos la estabilidad a la temperatura, fuerza salina y a valores extremos de pH, realizando finalmente un ensayo de simulación gástrica in-vitro y comprobando que el YBPCI mantiene su actividad inhibitoria intacta. Estos resultados alientan el estudio de su potencial actividad biológica, con el fin de emplear dicha molécula como potencial aditivo natural de alimentos, explotando así su capacidad conservante.Universidad Nacional de La Plat

Biochemical analysis of a papain-like protease isolated from the latex of Asclepias curassavica L.

Most of the species belonging to Asclepiadaceae family usually secrete an endogenous milk-like fluid in a network of laticifer cells in which sub-cellular organelles intensively synthesize proteins and secondary metabolites. A new papain-like endopeptidase (asclepain cII) has been isolated and characterized from the latex extracted from petioles of Asclepias curassavica L. (Asclepiadaceae). Asclepain cII was the minor proteolytic component in the latex, but showed higher specific activity than asclepain cI, the main active fraction previously studied. Both enzymes displayed quite distinct biochemical characteristics, confirming that they are different enzymes. Crude extract was purified by cation exchange chromatography (FPLC). Two active fractions, homogeneous by sodium dodecyl sulphate-polyacrylamide gel electrophoresis and mass spectrometry, were isolated. Asclepain cII displayed a molecular mass of 23,590 Da, a pI higher than 9.3, maximum proteolytic activity at pH 9.4-10.2, and showed poor thermostability. The activity of asclepain cII is inhibited by cysteine proteases inhibitors like E-64, but not by any other protease inhibitors such as 1,10-phenantroline, phenylmethanesulfonyl fluoride, and pepstatine. The N-terminal sequence (LPSFVDWRQKGVVFPIRNQGQCGSCWTFSA) showed a high similarity with those of other plant cysteine proteinases. When assayed on N-α-CBZ-amino acid-p-nitrophenyl esters, the enzyme exhibited higher preference for the glutamine derivative. Determinations of kinetic parameters were performed with N-α-CBZ-l-Gln-p-nitrophenyl ester as substrate: Km = 0.1634 mM, kcat = 121.48 s-1, and kcat/Km = 7.4 × 105 s-1/mM.Centro de Investigación de Proteínas VegetalesFacultad de Ciencias Exacta

Papain purification insights: monitoring by electrophoretic approaches and MALDI-TOF peptide mass fingerprint analyses

Papain was purified from dried Carica papaya latex by fractioned salt precipitation in presence of sodium tetrathionate to preserve enzymatic activity. Purification was followed by different electrophoretic methods. Identification of the purified product was afforded by submitting the peptides obtained by tryptic digestion of papain to matrix-assisted laser desorption/ionization-time of flight mass spectrometry (MALDI-TOF/TOF MS) analysis. Comparison of the peptide masses analyzed by peptide mass fingerprinting (PMF) MALDI-TOF and those obtained by theoretical tryptic digestion, revealed the presence of some peptides belonging the other three endopeptidases contained in papaya latex (very similar to papain in molecular weight and pI) in the purified fraction of papain. The PMF by MALDI-TOF could be applied as a method to follow papain purification.Centro de Investigación de Proteínas Vegetale

Papain purification insights: monitoring by electrophoretic approaches and MALDI-TOF peptide mass fingerprint analyses

Papain was purified from dried Carica papaya latex by fractioned salt precipitation in presence of sodium tetrathionate to preserve enzymatic activity. Purification was followed by different electrophoretic methods. Identification of the purified product was afforded by submitting the peptides obtained by tryptic digestion of papain to matrix-assisted laser desorption/ionization-time of flight mass spectrometry (MALDI-TOF/TOF MS) analysis. Comparison of the peptide masses analyzed by peptide mass fingerprinting (PMF) MALDI-TOF and those obtained by theoretical tryptic digestion, revealed the presence of some peptides belonging the other three endopeptidases contained in papaya latex (very similar to papain in molecular weight and pI) in the purified fraction of papain. The PMF by MALDI-TOF could be applied as a method to follow papain purification.Centro de Investigación de Proteínas Vegetale

Papain purification insights: monitoring by electrophoretic approaches and MALDI-TOF peptide mass fingerprint analyses

Papain was purified from dried Carica papaya latex by fractioned salt precipitation in presence of sodium tetrathionate to preserve enzymatic activity. Purification was followed by different electrophoretic methods. Identification of the purified product was afforded by submitting the peptides obtained by tryptic digestion of papain to matrix-assisted laser desorption/ionization-time of flight mass spectrometry (MALDI-TOF/TOF MS) analysis. Comparison of the peptide masses analyzed by peptide mass fingerprinting (PMF) MALDI-TOF and those obtained by theoretical tryptic digestion, revealed the presence of some peptides belonging the other three endopeptidases contained in papaya latex (very similar to papain in molecular weight and pI) in the purified fraction of papain. The PMF by MALDI-TOF could be applied as a method to follow papain purification.Centro de Investigación de Proteínas Vegetale

A Multifunctional Trypsin Protease Inhibitor from Yellow Bell Pepper Seeds: Uncovering Its Dual Antifungal and Hypoglycemic Properties

Fungal infections are a growing public health concern worldwide and the emergence of antifungal resistance has limited the number of therapeutic options. Therefore, developing novel strategies for identifying and developing new antifungal compounds is an active area of research in the pharmaceutical industry. In this study, we purified and characterized a trypsin protease inhibitor obtained from Yellow Bell Pepper (Capsicum annuum L.) seeds. The inhibitor not only showed potent and specific activity against the pathogenic fungus Candida albicans, but was also found to be non-toxic against human cells. Furthermore, this inhibitor is unique in that it also inhibits α-1,4-glucosidase, positioning it as one of the first plant-derived protease inhibitors with dual biological activity. This exciting discovery opens new avenues for the development of this inhibitor as a promising antifungal agent and highlights the potential of plant-derived protease inhibitors as a rich source for the discovery of novel multifunctional bioactive molecules.Fil: Cotabarren, Juliana. Consejo Nacional de Investigaciones Científicas y Técnicas. Centro Científico Tecnológico Conicet - La Plata; Argentina. Universidad Nacional de La Plata. Facultad de Ciencias Exactas. Departamento de Ciencias Biológicas. Laboratorio de Investigación de Proteínas Vegetales; ArgentinaFil: Ozón, Brenda. Universidad Nacional de La Plata. Facultad de Ciencias Exactas. Departamento de Ciencias Biológicas. Laboratorio de Investigación de Proteínas Vegetales; ArgentinaFil: Claver, Santiago Pablo. Universidad Nacional de La Plata. Facultad de Ciencias Exactas. Departamento de Ciencias Biológicas. Laboratorio de Investigación de Proteínas Vegetales; ArgentinaFil: Geier, Florencia Rocio. Universidad Nacional de La Plata. Facultad de Ciencias Exactas. Departamento de Ciencias Biológicas. Laboratorio de Investigación de Proteínas Vegetales; ArgentinaFil: Rossotti, Martina. Consejo Nacional de Investigaciones Científicas y Técnicas. Centro Científico Tecnológico Conicet - La Plata; Argentina. Universidad Nacional de La Plata. Facultad de Ciencias Exactas. Departamento de Ciencias Biológicas. Laboratorio de Investigación de Proteínas Vegetales; ArgentinaFil: Garcia Pardo, Javier. Universitat Autònoma de Barcelona; EspañaFil: Obregón, Walter David. Universidad Nacional de La Plata. Facultad de Ciencias Exactas. Departamento de Ciencias Biológicas. Laboratorio de Investigación de Proteínas Vegetales; Argentin