United States Agency for International Developmen

Bayoko, A.

Binam, Joachim N.

Dembele, C.

Diakite, A.

Zemadim, Birhanu

CGSpace

Engaging Development Partners in Africa RISING Research for better socioeconomic impacts in West Africa semi-arid countriesJoachim N. Binam1, Arouna Bayoko2, Adama Diakite1, Birhanu Zemadin3 and Catherine Dembele11World Agroforestry Centre (ICRAF)2Association Malienne d’Eveil au Development Durable (AMEDD)3International Crops Research Institute for the Semi-Arid Tropics (ICRISAT) Key messages There is a growing demand on agricultural research institutions to deliver development outcomes and impacts that are tractable and measurable Researchers who are dedicated to investigations aimed at finding out solutions to problems are less inclined or poorly equipped to be involved in elaborating how solutions can be delivered to users at large scale Development outcomes and impacts, nonetheless, represent the only evidence for return to investments in agricultural research that can be facilitated by well-identified development partners Strong stakeholder networks enhance programme implementation and outcomesThis poster is licensed for use under the Creative Commons Attribution 4.0 International Licence. January 2017We thank farmers and local partners in Africa RISING sites for their contributions to this research. We also acknowledge the support of all donors which globally support the work of the CGIAR centers and their partners through their contributions to the CGIAR systemObjectives and approachPropose some guidelines by using practical information to help the community of researchers and practitioners how to proceed in building effective and sustainable partnership for better impacts while implementing research in development or development programmes. This is achieved by using a stakeholder mapping, analysis and engagement framework.Key resultsOutputs from this process included among others:• Networks mapping for a visual and situation analysis of interactions and relationships among stakeholders (see figure 1); • Power/interest grids for stakeholders (table 3);• Plans for engaging, managing and communicating with key stakeholders for both programme implementation and scaling (table 3);• A baseline situation of networks and interactions for future comparisons on research deliverables on the process and method as well as the changes in stakeholder networks and roles over time (tables 1 & 2).Actors Goal, role, motivation Position in the network Level of influenceLevel of interest Potential role in the Agric. Dev ProgramEngagement strategyInform Consult Involve Collaborate EmpowerWV Improve local livelihoods through development support and capacity buildingProminent H L Capacity building, out scaling  YEREDON Support local communities through capacity building, promotion of networking and partnershipProminent/influential H L Sensitization, village-based training and extension  CMDT Improve local livelihoods through provision of innovations and technical advicesProminent H H Sensitization, networking and out scaling    Table 3: Stakeholder engagement planTable 1: Baseline networks structure in Sikasso regionTable 2: Baseline assessment of the roles play by network members in Sikasso Region Figure 1: Networks of stakeholder relationships in Menamba, Koumbia and Kifosso-Sikasso regionDesign and implementation of development programmes involves and affects many people within and external to the targetcommunities. Some of these people have power to constrain whilst others can facilitate successful programme delivery and up scaling.Thus stakeholder identification, engagement and management are key to success.Measures MENAMBA KOUMBIA KIFOSSOBaseline Follow up Baseline Follow up Baseline Follow upNetwork density5% 3% 4%Inclusiveness 89% 91% 94%MENAMBA KOUMBIA KIFOSSOBaseline Follow up Baseline Follow up Baseline Follow upActors with a prominent role AMEDDEPC/CMDTCDDMJGMJRAMEDDCPCVCMDTBNDAAMEDDCMDTKAFOBNDAActors with influential role CDMCPCVS1MNB3MNB1WM1KM1SM1CPCVM1DJMCPCVSMTBKCPCVKKCPCVSSSMNCPCVDLKBRNONSMNDRSNGRNWGLFLKMMNYRGNSKSRLSTAGBGCPCVK3CPCVBKCPCVNNbKCPCVL2KKAFOCPCVM4KCPCVL1KBBGK1TGRBGKKFS2Network bonder actors AMEDDCDDMCDMAMEDDSTACPCVCMDTAMEDDCMDTMembers not involved GMAMDZMHUNICEFBoFonODESZMHAWKKBZKSNGSGSCPCVZJK

Engaging development partners in Africa RISING research for better socioeconomic impacts in West Africa semi-arid countries

https://cgspace.cgiar.org/bitstream/handle/10568/80418/AR_dar217_binam.pdf?sequence=1&isAllowed=y

Engaging development partners in Africa RISING research for better socioeconomic impacts in West Africa semi-arid countries

Abstract

Similar works

Full text

Available Versions

CGSpace