Neglected Effects of Inoculum Preservation on the Start-Up of Psychrophilic Bioelectrochemical Systems and Shaping Bacterial Communities at Low Temperature

Bioelectrochemical systems (BESs) are capable of simultaneous wastewater treatment and resource recovery at low temperatures. However, the direct enrichment of psychrophilic and electroactive biofilms in BESs at 4°C is difficult due to the lack of understanding in the physioecology of psychrophilic exoelectrogens. Here, we report the start-up and operation of microbial fuel cells (MFCs) at 4°C with pre-acclimated inocula at different temperatures (4°C, 10°C, 25°C, and −20°C) for 7 days and 14 days. MFCs with 7-day-pretreated inocula reached higher peak voltages than did those with 14-day-pretreated inocula. The highest power densities were obtained by MFCs with 25°C – 7-day-, 25°C – 14-day-, and 4°C – 7-day-pretreated inocula (650–700 mW/m2). In contrast, the control MFCs with untreated inocula were stable at 450 mW/m2. The power densities of MFCs with 7-day-pretreated inocula were higher than those obtained by MFCs with 14-day-pretreated inocula. The MFCs with 10°C – 7-day-pretreated inocula and the control MFCs showed higher chemical oxygen demand (COD) removal (90–91%) than other MFCs. Illumina HiSeq sequencing based on 16S rRNA gene amplicons indicated that bacterial communities of the anode biofilms were shaped by pretreated inocula at different temperatures. Compared with the control MFCs with untreated inocula, MFCs with temperature-pretreated inocula demonstrated higher microbial diversity, but did not do so with −20°C-pretreated inocula. Principal components analysis (PCA) revealed an obvious separation between the inocula pretreated at 4°C and those pretreated at 10°C, implying that bacterial community structures could be shaped by pretreated inocula at low temperatures. The pretreatment period also had a diverse impact on the abundance of exoelectrogens and non-exoelectrogens in MFCs with inocula pretreated at different temperatures. The majority of the predominant population was affiliated with Geobacter with a relative abundance of 17–70% at different pre-acclimated temperatures, suggesting that the exoelectrogenic Geobacter could be effectively enriched at 4°C even with inocula pretreated at different temperatures. This study provides a strategy that was previously neglected for fast enrichment of psychrophilic exoelectrogens in BESs at low temperatures

Direct visualization of electric current induced dipoles of atomic impurities

Learning the electron scattering around atomic impurities is a fundamental step to fully understand the basic electronic transport properties of realistic conducting materials. Although many efforts have been made in this field for several decades, atomic scale transport around single point-like impurities has yet been achieved. Here, we report the direct visualization of the electric current induced dipoles around single atomic impurities in epitaxial bilayer graphene by multi-probe low temperature scanning tunneling potentiometry as the local current density is raised up to around 25 A/m, which is considerably higher than that in previous studies. We find the directions of these dipoles which are parallel or anti-parallel to local current are determined by the charge polarity of the impurities, revealing the direct evidence for the existence of the carrier density modulation effect proposed by Landauer in 1976. Furthermore, by $in$ $situ$ tuning local current direction with contact probes, these dipoles are redirected correspondingly. Our work paves the way to explore the electronic quantum transport phenomena at single atomic impurity level and the potential future electronics toward or beyond the end of Moore's Law

A method to predict whether middle school students will enter STEM careers in the future based on FC-Wide&Deep model

STEM education is a hot issue in modern education, and it is important to study whether middle school students enter STEM careers in the future in the early stage of career planning. In this paper, we collected students’ behavioral data through the online tutoring platform ASSISTments, divided the raw log data into five types: single-valued, binary-valued, multi-valued, continuous-valued and cumulative, and aggregated them using different data reconstruction methods. Then, a width & depth prediction model based on feature crossover is proposed to perform feature crossover on the aggregated data, and then the depth and width models are jointly trained using. During the training process, the AUC of the FC-Wide&Deep model improved rapidly from 0.800 to 0.845 in the 1st to 16th training rounds, and then slowly climbed with the increase of training rounds. By averaging the results of the three tests, the AUC index of the FC-Wide&Deep model test results improved by 1.29% compared to the DNN model, and the RMSE index improved by 2.08% compared to the BSN-FM model. The FC-Wide&Deep model is generalizable and generalizable, and can be applied to predict whether students will enter STEM careers in the future, thus contributing to the cultivation and leadership of STEM talents in the field of education

Improved digital breast tomosynthesis images using automated ultrasound

Peer Reviewedhttp://deepblue.lib.umich.edu/bitstream/2027.42/135015/1/mp5980.pd

Impacts of Climate and Environmental Change on Bean Cultivation in China

The impact of human-caused environmental pollution and global climate change on the economy and society can no longer be underestimated. Agriculture is the most directly and vulnerably affected sector by climate change. This study used beans, the food crop with the largest supply and demand gap in China, as the research object and established a panel spatial error model consisting of multiple indicators of four factors: climate environment, economic market, human planting behavior and technical development level of 25 provinces in China from 2005 to 2019 to explore the impact of climate environmental changes on the yields of beans. The study shows that: (1) The increase in precipitation has a significant positive effect on bean yields; however, the increase in temperature year by year has a significant negative effect on bean yields; (2) carbon emissions do not directly affect bean production at present but may have an indirect impact on bean production; (3) artificial irrigation and fertilization behavior on bean production has basically reached saturation, making it difficult to continue to increase bean yields and (4) the development of technology and human activity is a mixed blessing, and the consequent inhibiting effects on bean production are currently unable to offset their promoting effects. Thus, when it comes to bean cultivation, China should focus mainly on the overall impact of environmental changes on its production, rather than technical enhancements such as irrigation and fertilization

Screening and diversity of culturable HNAD bacteria in the MBR sewage treatment system.

The activated sludge was collected from the Membrane BioReactor (MBR) pool of the sewage treatment system of Sanxing Town, Jintang County, Chengdu, to obtain a good population of heterotrophic nitrifying/aerobic denitrifying (HNAD) bacteria. After undergoing enrichment, isolation, and purification, the HNAD bacteria were selected using the pure culture method. The 16S rDNA molecular technology was used to determine the taxonomy of bacteria. The heterophic nitrifying ability and denitrification capacity of HNAD strains was ascertained through their growth characteristics in heterotrophic nitrification and denitrification media. The results showed that 53 HNAD strains selected from the MBR pool belonged to 2 phyla, 3 classes, 6 orders, 6 families, and 7 genera, with 26 species. Acinetobacter was the largest and dominant genus. Among these, strains numbered (bacterial strain) SW21HD14, SW21HD17, and SW21HD18 were potentially new species in the Acinetobacter genus. Each HNAD strain showed a significant heterotrophic nitrifying and aerobic denitrifying efficiency compared with the control strain (P < 0.05). Specifically, 10 strains demonstrated ammonia nitrogen degradation of greater than 70 mg·L-1 and 9 strains demonstrated nitrate nitrogen degradation above 150 mg·L-1. The HNAD bacteria, which were selected from the MBR pool of sewage treatment system of the Sanxing Town sewage treatment plant, exhibited rich diversity and strong nitrogen removal ability. These findings offered an effective strain source and theoretical basis for implementing biological denitrification technology that involves synchronous nitrification and denitrification

pH-Responsive Tumor-Targetable Theranostic Nanovectors Based on Core Crosslinked (CCL) Micelles with Fluorescence and Magnetic Resonance (MR) Dual Imaging Modalities and Drug Delivery Performance

The development of novel theranostic nanovectors is of particular interest in treating formidable diseases (e.g., cancers). Herein, we report a new tumor-targetable theranostic agent based on core crosslinked (CCL) micelles, possessing tumor targetable moieties and fluorescence and magnetic resonance (MR) dual imaging modalities. An azide-terminated diblock copolymer, N3-POEGMA-b-P(DPA-co-GMA), was synthesized via consecutive atom transfer radical polymerization (ATRP), where OEGMA, DPA, and GMA are oligo(ethylene glycol)methyl ether methacrylate, 2-(diisopropylamino)ethyl methacrylate, and glycidyl methacrylate, respectively. The resulting diblock copolymer was further functionalized with DOTA(Gd) (DOTA is 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetrakisacetic acid) or benzaldehyde moieties via copper(I)-catalyzed alkyne-azide cycloaddition (CuAAC) chemistry, resulting in the formation of DOTA(Gd)-POEGMA-b-P(DPA-co-GMA) and benzaldehyde-POEGMA-b-P(DPA-co-GMA) copolymers. The resultant block copolymers co-assembled into mixed micelles at neutral pH in the presence of tetrakis[4-(2-mercaptoethoxy)phenyl]ethylene (TPE-4SH), which underwent spontaneous crosslinking reactions with GMA residues embedded within the micellar cores, simultaneously switching on TPE fluorescence due to the restriction of intramolecular rotation. Moreover, camptothecin (CPT) was encapsulated into the crosslinked cores at neutral pH, and tumor-targeting pH low insertion peptide (pHLIP, sequence: AEQNPIYWARYADWLFTTPLLLLDLALLVDADEGTCG) moieties were attached to the coronas through the Schiff base chemistry, yielding a theranostic nanovector with fluorescence and MR dual imaging modalities and tumor-targeting capability. The nanovectors can be efficiently taken up by A549 cells, as monitored by TPE fluorescence. After internalization, intracellular acidic pH triggered the release of loaded CPT, killing cancer cells in a selective manner. On the other hand, the nanovectors labeled with DOTA(Gd) contrast agents exhibited increased relaxivity (r1 = 16.97 mM−1·s−1) compared to alkynyl-DOTA(Gd) small molecule precursor (r1 = 3.16 mM−1·s−1). Moreover, in vivo MRI (magnetic resonance imaging) measurements revealed CCL micelles with pHLIP peptides exhibiting better tumor accumulation and MR imaging performance as well

Screening and biodiversity analysis of cultivable inorganic phosphate-solubilizing bacteria in the rhizosphere of Hydrilla verticillata.

The inorganic phosphate-solubilizing bacteria (IPB) in the rhizosphere of Hydrilla verticillata can convert insoluble inorganic phosphorus in the environment into soluble phosphorus that can be directly absorbed and utilized by Hydrilla verticillata. In this research, the roots and rhizosphere sediments of Hydrilla verticillata were collected from high-organic matter urban landscape water. The National Botanical Research Institute's Phosphate growth medium (NBRIP medium) was used to screen for efficient cultivable IPB. The 16S rRNA gene sequence analysis was used to determine the taxonomic affiliation of the strains, and ammonium molybdate spectrophotometry was used to detect the phosphate-solubilizing ability of the strains. The results show that a total of 28 IPB strains with good phosphate-solubilizing effect are obtained from the roots and rhizosphere sediments of Hydrilla verticillata. These IPB strains belong to two phyla, four orders, seven classes, nine families, and nine genera. Among these, Bacillus and Acinetobacter are the dominant genera, and the strains SWIH-7, SWIP-6, SWIP-7, SWIP-13, SWIP-15 and SWIP-16 are potential new species. The IPB strains isolated and screened in this research are rich in diversity, with potential new species and stable phosphate-solubilizing characteristic. These IPB strains are suitable for further development as microbial bacterial agents, which can be applied to promote the recovery of submerged plants in polluted water with high-organic matter, treatment of polluted water and ecological restoration of water

Dynamic capacity modelling of soil environment carrying capacity, and developing a soil quality early warning framework for development land in China

The knowledge of soil environmental quality and its changing trends is important for safe and sustainable land utilization. However, comprehensive information on soil environment carrying capacity, involving environmental, economic and social pressures, is relatively rare. In this study, a modified dynamic capacity model is developed to estimate soil environment carrying capacity in terms of a combined consideration of soil environment capacity, cumulative input/output rate and risk characteristics. Based on the method proposed, this paper demonstrates the current pollution status and remaining soil capacity of the Beijing urban area, and establishes a conceptual “early warning” model for soil environmental quality, to predict time-dependent changing patterns of soil pollutants under different accumulation scenarios. The results showed that for Beijing soil environmental carrying capacity varied with land use type and pollutant. Compared with Cu, Zn and Pb, Cd posed the greatest threat to soil environmental carrying capacity in both residential areas and green parks. Heavy metal carrying capacity in soils in built-up areas in Beijing was not overloaded currently, and will not deteriorate significantly over the short-to medium-term in a hypothetical “decreased input” scenario. The method proposed provides a simple, cost-effective, and quantitative tool for mapping soil quality level, and assessing the need for risk management measures, in China and elsewhere