39 research outputs found
Recollements induced by left Frobenius pairs
Let be a right exact functor from an abelian category into
another abelian category . Then there exists an abelian category,
named comma category and denoted by .In this paper,
we construct left Frobenius pairs (resp. strong left Frobenius pairs) over
using left Frobenius pairs (resp. strong left
Frobenius pairs) over and As a consequence, we
obtain a recollement of (right) triangulated categories, generalizing the
result of Xiong-Zhang-Zhang (J. Algebra 503 (2018) 21-55) about the recollement
of additive (resp. triangulated) categories constructed from a triangular
matrix algebra. This result is applied to the classes of flat modules and
Gorenstein flat modules, the classes of Gorenstein projective modules and
Gorenstein projective complexes, the class of Ding projective modules and the
class of Gorenstein flat-cotorsion modules.Comment: 24 pages, all comments are welcom
RS-SVM Machine Learning Approach Driven by Case Data for Selecting Urban Drainage Network Restoration Scheme
ABSTRACTUrban drainage pipe network is the backbone of urban drainage, flood control and water pollution prevention, and is also an essential symbol to measure the level of urban modernization. A large number of underground drainage pipe networks in aged urban areas have been laid for a long time and have reached or practically reached the service age. The repair of drainage pipe networks has attracted extensive attention from all walks of life. Since the Ministry of ecological environment and the national development and Reform Commission jointly issued the action plan for the Yangtze River Protection and restoration in 2019, various provinces in the Yangtze River Basin, such as Anhui, Jiangxi and Hunan, have extensively carried out PPP projects for urban pipeline restoration, in order to improve the quality and efficiency of sewage treatment. Based on the management practice of urban pipe network restoration project in Wuhu City, Anhui Province, this paper analyzes the problems of lengthy construction period and repeated operation caused by the mismatch between the design schedule of the restoration scheme and the construction schedule of the pipe network restoration in the existing project management mode, and proposes a model of urban drainage pipe network restoration scheme selection based on the improved support vector machine. The validity and feasibility of the model are analyzed and verified by collecting the data in the project practice. The research results show that the model has a favorable effect on the selection of urban drainage pipeline restoration schemes, and its accuracy can reach 90%. The research results can provide method guidance and technical support for the rapid decision-making of urban drainage pipeline restoration projects
Inducing Effect of Dihydroartemisinic Acid in the Biosynthesis of Artemisinins with Cultured Cells of Artemisia annua
Artemisinin has been used in the production of “artemisinin combination therapies” for the treatment of malaria. Feeding of precursors has been proven to be one of the most effective methods to enhance artemisinin production in plant cultured cells. At the current paper, the biosynthesis of artemisinin (ART) and its four analogs from dihydroartemisinic acid (DHAA) in suspension-cultured cells of Artemisia annua were investigated. ARTs were detected by HPLC/GC-MS and isolated by various chromatography methods. The structures of four DHAA metabolites, namely, dihydro-epi-deoxyarteannuin B, arteannuin I, arteannuin K, and 3-β-hydroxy-dihydro-epi-deoxyarteannuin B, were elucidated by physicochemical and spectroscopic analyses. The correlation between gene expression and ART content was investigated. The results of RT-PCR showed that DHAA could up-regulate expression of amorpha-4,11-diene synthase gene (ADS), amorpha-4,11-diene C-12 oxidase gene (CYP71AV1), and farnesyl diphosphate synthase gene (FPS) (3.19-, 7.21-, and 2.04-fold higher than those of control group, resp.), which indicated that biosynthesis processes from DHAA to ART were enzyme-mediated
Recollements induced by good (co)silting dg-modules
summary:Let be a dg--module, the endomorphism dg-algebra of . We know that if is a good silting object, then there exist a dg-algebra and a recollement among the derived categories of , of and of . We investigate the condition under which the induced dg-algebra is weak nonpositive. In order to deal with both silting and cosilting dg-modules consistently, the notion of weak silting dg-modules is introduced. Thus, similar results for good cosilting dg-modules are obtained. Finally, some applications are given related to good 2-term silting complexes, good tilting complexes and modules.\looseness -
The Inhibitory Effect of a Novel Polypeptide Fraction from Arca subcrenata on Cancer-Related Inflammation in Human Cervical Cancer HeLa Cells
Inflammation is known to be closely associated with the development of cancer. The study was launched in human cervical cancer HeLa cells to investigate the antitumor and anti-inflammatory effects of P2, a marine polypeptide fraction from an important fishery resource Arca subcrenata. The basic research showed that P2 could suppress the production of nitric oxide in LPS-induced RAW264.7 macrophage cells as well as the secretion of inflammatory cytokines IL-6 and TNF-α in human cervical cancer HeLa cells. For the molecular mechanisms, P2 was shown to downregulate the gene expression of proinflammatory cytokines IL-6 and IL-8 and to inhibit the COX-2 and iNOS-related pathways in HeLa cells. In consequence, P2 might inhibit tumor development by blocking the interaction between tumor microenvironment and proinflammatory mediators. All findings indicate that P2 possesses the potential to be developed as a novel agent for cancer therapy
Four New Compounds Obtained from Cultured Cells of Artemisia annua
Four new compounds obtained from cultured cells of Artemisia annua were reported. Products were detected by HPLC-ELSD/GC-MS and isolated by chromatographic methods. The structures of four new compounds, namely 6-hydroxy arteannuin I (1), 1-hydroxy arteannuin I (2), 2-hydroxy arteannuin J (3), and 14-hydroxy arteannuin J (4), were elucidated using their physico-chemical properties by NMR and MS data analyses. The results from the spontaneous oxidative experiment indicated that the biosynthesis of the new compounds was enzyme-catalyzed. Interestingly, the enzymes in the cultured cells of A. annua showed the abilities of substrate-selective and region-selective hydroxylation of the sesquiterpene lactone. Furthermore, the artemisinin contents were increased by 50% and 80% compared to the control group after the addition of arteannuin I/J to the suspension-cultured cells of A. annua under light and dark culture conditions, respectively
A New Antiproliferative and Antioxidant Peptide Isolated from Arca subcrenata
A new antitumor and antioxidant peptide (H3) was isolated from Arca subcrenata Lischke using ion exchange and hydrophobic column chromatography. The purity of H3 was over 99.3% in reversed phase-high performance liquid chromatography (RP-HPLC) and the molecular weight was determined to be 20,491.0 Da by electrospray-ionization mass spectrometry (ESI-MS/MS). The isoelectric point of H3 was measured to be 6.65 by isoelectric focusing-polyacrylamide gel electrophoresis. Partial amino acid sequence of this peptide was determined as ISMEDVEESRKNGMHSIDVNH DGKHRAYWADNTYLM-KCMDLPYDVLDTGGKDRSSDKNTDLVDLFELDMVPDRK NNECMNMIMDVIDTN-TAARPYYCSLDVNHDGAGLSMEDVEEDK via MALDI-TOF/ TOF-MS and de novo sequencing. The in vitro antitumor activity of H3 was evaluated by 3-(4,5-dimethyl-2-thiazolyl)-2,5-diphenyl-2H-tetrazolium bromide (MTT) assay. The result indicated that H3 exhibited significant antiproliferative activity against HeLa, HepG2 and HT-29 cell lines with IC50 values of 10.8, 10.1 and 10.5 μg/mL. The scavenging percentage of H3 at 8 mg/mL to 2,2-diphenyl-1-picrylhydrazyl (DPPH) and hydroxyl radicals were 56.8% and 47.5%, respectively